PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast09G268800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 338aa    MW: 37143.2 Da    PI: 6.556
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast09G268800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.79.2e-53151561128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...............kvkaeek.....ewyfFskrdkkyatg 71 
                         +ppGfrFhPt+eelv +yL++kv+++k++l ++i+evd+y++ePwdL++                     +     ewyfFs +d+ky++g
  Brast09G268800.1.p  15 VPPGFRFHPTEEELVGYYLARKVASQKIDL-DIIQEVDLYRIEPWDLQElcgrqystggaghdeD-----NsrpaaEWYFFSFKDRKYPSG 99 
                         69****************************.99**************966888888776654321.....123456*************** PP

                 NAM  72 krknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +r+nrat++g+Wkatg+dk+vls +++++g++ktLvfy+grap+g+kt+W+mheyrl
  Brast09G268800.1.p 100 TRTNRATAAGFWKATGRDKPVLSPSSRVIGMRKTLVFYRGRAPNGRKTEWIMHEYRL 156
                         *******************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.32E-5713177IPR003441NAC domain
PROSITE profilePS5100556.54215177IPR003441NAC domain
PfamPF023659.9E-2816156IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MEHHQGQQDD QSCCVPPGFR FHPTEEELVG YYLARKVASQ KIDLDIIQEV DLYRIEPWDL  60
QELCGRQYST GGAGHDEDNS RPAAEWYFFS FKDRKYPSGT RTNRATAAGF WKATGRDKPV  120
LSPSSRVIGM RKTLVFYRGR APNGRKTEWI MHEYRLQSSE HAPTPEEGWV VCRAFHKPIP  180
NMQMHLARPP LPFVIPGAVG PASGYYANDI DARLSGHGHA GDLLNYLHPA AAASNSGGGF  240
VFPGNGNGNG NGSGHGAQLV LSEDLVESKK HLNIFPQLIE SPANEDDQAG AGQQQAAAGA  300
IDWNFLDSLL SSTSSSSQQL IHDSSQSQLM MHLQQHH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-491517715168Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ6934261e-124JQ693426.1 Brachypodium distachyon SWN5 (SWN5) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010240666.11e-143PREDICTED: protein SOMBRERO isoform X2
SwissprotO655085e-85NAC76_ARATH; NAC domain-containing protein 76
TrEMBLA0A0Q3HBL11e-143A0A0Q3HBL1_BRADI; Uncharacterized protein
STRINGBRADI5G27467.11e-142(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25943791
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36160.11e-84NAC domain containing protein 76